PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca29703.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family LBD
Protein Properties Length: 226aa    MW: 24046.2 Da    PI: 7.7672
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca29703.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.91e-4471061100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC+++Cv+apyfp +qp++fanvhk+FGasnv kll++lp  +reda++sl+yeAear+rdPvyG+vg+i+ lqq+l+q++++l ++k+
  Dca29703.1   7 PCAACKFLRRKCTQECVFAPYFPPDQPQRFANVHKVFGASNVAKLLNELPAAQREDAVNSLAYEAEARLRDPVYGCVGLISVLQQKLKQVQSDLITAKK 105
                 7********************************************************************************************999988 PP

      DUF260 100 e 100
                 e
  Dca29703.1 106 E 106
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.216107IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-447104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQRFANVH KVFGASNVAK LLNELPAAQR  60
EDAVNSLAYE AEARLRDPVY GCVGLISVLQ QKLKQVQSDL ITAKKELATY IGPSALNATM  120
FPSPAYNVGA GGAGPSAVNA GVLGGYNMAN HMMGITTNTQ GASAAQQQSA QQMIEAQQQM  180
AAAVMKEEQE MMRNWEQQQQ FMRFNAGSSS GGGGFCGTYE VGGGAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010687953.18e-87PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ31e-70LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0J8BSE49e-87A0A0J8BSE4_BETVU; Uncharacterized protein
STRINGSolyc02g065150.1.11e-79(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.18e-69ASYMMETRIC LEAVES 2-like 1